bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1495_orf2 Length=221 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_1370 63.2 6e-09 > 5807.cgd8_1370 Length=428 Score = 63.2 bits (152), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 36/82 (43%), Positives = 52/82 (63%), Gaps = 1/82 (1%) Query 1 RVQVSVYQVARSLTLVFSLLLSVFWLKQKVVRAEVFSCLFVAMGFALMTAVGSDTASVTG 60 V VS YQVARS T++F+L+LS LKQK V SC+ V +GF + +A S+T ++ G Sbjct 204 HVLVSTYQVARSTTIIFNLILSYKILKQKSSIFTVASCIIVMIGFTI-SAFDSNTLNLNG 262 Query 61 YIMGALASLFQATYTVQMKATL 82 I G +S+ Q+ Y+V +K L Sbjct 263 VIYGVFSSIIQSFYSVLIKKQL 284 Lambda K H 0.315 0.129 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 59781045954 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40