bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1438_orf2 Length=174 Score E Sequences producing significant alignments: (Bits) Value 203119.Cthe_1031 65.5 8e-10 > 203119.Cthe_1031 Length=477 Score = 65.5 bits (158), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 40/104 (38%), Positives = 62/104 (59%), Gaps = 4/104 (3%) Query 9 RVEIKNVRSLRAIRRALHAEDKRQKDIIEKGQEIQPETRHWDDALKRSVPLRSKVNS-SW 67 R E+KN+ S+R++ RA+ +E KRQ ++IE G I ETR WD+ S +R+K + + Sbjct 210 RTEMKNLNSIRSMVRAIESEAKRQIEVIESGGIIVQETRRWDEHKGVSCSMRTKEEAHDY 269 Query 68 VFFPFEETQIPPVSLDKETKARIKRGL-VLSAASRRSLYRQWGL 110 +FP E + P+ +D+E K IKR L L A R+ ++GL Sbjct 270 RYFP--EPDLMPIVVDEEWKEEIKRSLPELPDARRKRYVNEYGL 311 Lambda K H 0.319 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 34096907735 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40