bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1421_orf1 Length=151 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_1300 75.1 5e-13 > 5807.cgd2_1300 Length=677 Score = 75.1 bits (183), Expect = 5e-13, Method: Composition-based stats. Identities = 40/101 (39%), Positives = 61/101 (60%), Gaps = 5/101 (4%) Query 3 INSCYTLD-ETIGLGSFGCRVYRATDILSGVRRVVKCVSKDQPEGVRIWRNEISFLRRIH 61 IN Y L+ +G GS+G V +A D SG +R VK + K + E + + EI ++R+ Sbjct 180 INDFYELNLGNLGRGSYG-SVVKAIDKQSGAQRAVKIILKPKLENINRLKREILIMKRLD 238 Query 62 HPNVVRIFEVFEEPAAVYHVTETCYGGDLHQWLDRRLRRRH 102 HPN++++FEVFE+ +Y V E C GG+L DR ++R H Sbjct 239 HPNIIKLFEVFEDTNYLYFVMEICTGGEL---FDRIIKRGH 276 Lambda K H 0.324 0.137 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22675567716 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40