bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1419_orf1 Length=180 Score E Sequences producing significant alignments: (Bits) Value 44689.DDB_0201629 145 6e-34 > 44689.DDB_0201629 Length=1432 Score = 145 bits (366), Expect = 6e-34, Method: Compositional matrix adjust. Identities = 83/180 (46%), Positives = 104/180 (57%), Gaps = 28/180 (15%) Query 1 IDRPSEIDVRDSGGKVLSHETFKGEIDVDRINFTYPTRPDNRVYRNLTFSIKEGEAVALV 60 IDR S+ + + G + ET GEI+ + F YP+RPD ++ IK G+ V LV Sbjct 491 IDRQSKANPFSTRG--IKPETLSGEIEFKDVGFHYPSRPDVPIFNGFNLKIKPGQTVGLV 548 Query 61 GASGCGKSTIVQLVERFYDLKSTYKVKPVSQSEQGEPNKEAERVHISEGRILLDGDDLRE 120 G SG GKSTI+ L+ERFYD P +G ILLDG+D+R+ Sbjct 549 GDSGGGKSTIISLLERFYD--------PC------------------QGEILLDGEDIRK 582 Query 121 LNVVSVRQQEGLVSQEPILFDMTIEENIAISKPGATQEEIREAAKLANAAGFISTFPAGY 180 NV +RQ+ GLV+QEP+LF TI ENI K GATQ+EI EAAKLANA FIS P GY Sbjct 583 FNVRGLRQKIGLVNQEPVLFATTISENIRYGKEGATQDEIEEAAKLANAHSFISQLPQGY 642 Lambda K H 0.314 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 37047630060 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40