bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1416_orf3 Length=269 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_2260 114 4e-24 > 5807.cgd2_2260 Length=677 Score = 114 bits (284), Expect = 4e-24, Method: Compositional matrix adjust. Identities = 75/219 (34%), Positives = 110/219 (50%), Gaps = 31/219 (14%) Query 58 PLIALSIC--TITKKVEPAGRSFFDKYEKRTPSK---HRRKQDASPTPPPEEDEEYNERT 112 P+I S+ KK+EP G +FF +YE + +K + K + P + Y++ Sbjct 24 PVIQSSVAEFAFKKKIEPVGEAFFYRYEVKYSNKINFLKEKIKIESSIPI--NNIYSQ-- 79 Query 113 EKWRAKSKNKSPGGGGGGSSSSWASGTHLKRILAYNQTLYQILGVEDGASLDEIKKQYRK 172 E+ + KSK S G + S LK ++ +TLY+ LG+++ + EIK+ YR+ Sbjct 80 EECKKKSKKISGNKSGNKLAKGVLSLARLKELVEEKETLYEKLGLDENVCVKEIKQAYRR 139 Query 173 KVLEYHPDKAKSTATSPSGETTTATPTSAAAEGLPSSEHGAFLKVQEAYEALSDSNFRKQ 232 VL +HPDK K ++ E FLK+QEAYE LSD N R Sbjct 140 LVLSHHPDKNKENSSDARSE--------------------EFLKIQEAYEILSDKNLRHA 179 Query 233 YDSSLPFDESIPD--AAECEDGAKFYETFGAAFHRNARW 269 YDS+LPFD+SIP +E D +F + F F RN+RW Sbjct 180 YDSALPFDDSIPSVYVSENNDFYEFKDFFSPIFRRNSRW 218 Lambda K H 0.311 0.128 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 86166200835 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40