bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1262_orf4 Length=324 Score E Sequences producing significant alignments: (Bits) Value 8364.ENSXETP00000043770 71.2 5e-11 > 8364.ENSXETP00000043770 Length=404 Score = 71.2 bits (173), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 37/117 (31%), Positives = 66/117 (56%), Gaps = 7/117 (5%) Query 138 LPPVDIHLILAAESGVVVKVCDSGNGLCLTEQQLAWRFLYSTRTMPVDRQNKTRAGSAAA 197 LPPV+++++L E + +K+ D+G G+ L + + + ++YST P+ S A Sbjct 270 LPPVEVNVVLGNED-LTIKISDNGGGVPLRKIERLFSYMYSTAPRPL------MDNSRNA 322 Query 198 LFSGWGVGLPLTRMYARALGGDAFMESRIGRGTRSYLYVPDISPTACTASPQTNSAA 254 +G+G GLP++R+YAR GD ++S G GT + +Y+ +S + P N +A Sbjct 323 PLAGFGYGLPISRLYARYFQGDLMLQSMEGFGTDAVIYLKALSTESVERLPVFNKSA 379 Lambda K H 0.316 0.125 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 117128481428 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40