bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1208_orf2 Length=129 Score E Sequences producing significant alignments: (Bits) Value 51511.ENSCSAVP00000004888 77.4 1e-13 > 51511.ENSCSAVP00000004888 Length=706 Score = 77.4 bits (189), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 45/124 (36%), Positives = 64/124 (51%), Gaps = 19/124 (15%) Query 6 LSFVLDLTNSAGIRVVGNIPKGFPKPAAPTFSISYATITDGGETVVQQRNVCVAMLREAL 65 +S+ DL + ++++GNIP G P P AP+ D T+V Q ++ Sbjct 311 ISYAADLERNYNVKIIGNIPSGLPVPVAPS--------ADRFSTIVGQ----------SI 352 Query 66 ALTAMFFVIHISIAKTIAQQKRTYSIRPDQELVALSMCNLVGCCFQCFPNATSLSRSCVV 125 + + + + +SIAK A Y IRP+QELVA NLV FQCFP S+SRSCV Sbjct 353 PIAVVGYAVAVSIAKIFANN-FGYKIRPNQELVAFGASNLVSSFFQCFPAFPSMSRSCVQ 411 Query 126 AAAG 129 +G Sbjct 412 VDSG 415 Lambda K H 0.327 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22342951125 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40