bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1170_orf1 Length=159 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_3420 73.6 2e-12 > 5807.cgd5_3420 Length=3869 Score = 73.6 bits (179), Expect = 2e-12, Method: Composition-based stats. Identities = 42/127 (33%), Positives = 65/127 (51%), Gaps = 4/127 (3%) Query 2 LRCETRAVNVQYIKAFIRNAGDLQYGAVPALFAAFSSALRVQPPDELRLLAVGLDRRD-- 59 +CE V V ++ I A DL + AV +++ A S L V P+ LR+ A+ R + Sbjct 2327 FKCEEPHVEVMQVEMEIEEASDLDFTAVSSIYTALYSTLPVYQPNGLRIEAISTTRFENI 2386 Query 60 -GGGRASLVCED-DPRVAEMGYSCSMMEAFCDSKLHDLAAAQKKQLPSWLPKDAKVKDAC 117 G G+ + CED + ++ G +CSM++ FC L +LA + +P + D KV AC Sbjct 2387 LGDGQQDIKCEDQNHQLKSFGINCSMLKPFCSKTLEELAKQFNRSIPDGVSADIKVSIAC 2446 Query 118 RKTCGAC 124 TC C Sbjct 2447 PVTCDNC 2453 Lambda K H 0.322 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26246233818 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40