bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1123_orf3 Length=137 Score E Sequences producing significant alignments: (Bits) Value 59463.ENSMLUP00000007099 72.0 5e-12 > 59463.ENSMLUP00000007099 Length=366 Score = 72.0 bits (175), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 13/100 (13%) Query 28 GGYPGGAPGGMSGSMPGGIPGGVPGGMPGGMGGLEGMSVVFFAGGLLGSVNDPDVQQVFS 87 G +PG PGGMSG+ GG+P GGMPG M G+ G++ + +DP+V Sbjct 278 GSFPGF-PGGMSGNFSGGMPR--IGGMPG-MAGMPGLNEIL---------SDPEVLAAMQ 324 Query 88 NPKMMAAFQDILTNPGNMAKYKDDPEVADAISKLMRKFGG 127 +P++M AFQD+ NP NM+KY+ +P+V + ISKL KFGG Sbjct 325 DPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFGG 364 Lambda K H 0.316 0.144 0.452 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22428990562 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40