bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1114_orf1 Length=213 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd3_3380 154 1e-36 > 5807.cgd3_3380 Length=664 Score = 154 bits (390), Expect = 1e-36, Method: Composition-based stats. Identities = 68/165 (41%), Positives = 109/165 (66%), Gaps = 8/165 (4%) Query 1 DLLFAFGFENDTKRLLQLLPSTAARHYQTILVSATQNHELSQLQHLMLHKPLIIKI---- 56 DLLFAFG++ D ++L LLP++ R YQ IL+SAT N E+ L+ ++LH+P+ + I Sbjct 181 DLLFAFGYDKDMSKVLDLLPNSQDRKYQCILLSATLNKEVDSLKKMVLHRPIFVDIKPEI 240 Query 57 ----VEEEGSHADGSAASCISEFYFQVPTEAEKWLVAYAFLRLGLVPLKCLVFCKDVSSV 112 ++EG+ + + +SE+Y + +KWL+ Y L++ ++P KCL+F +V + Sbjct 241 KEDYFDQEGNDSKCQTSGLLSEYYTICDSMVDKWLMLYILLKMNVIPRKCLIFVSEVDTA 300 Query 113 YALRLFLDRFGIASGVLSPTLPVAAREQQIQAFNQGLIDILITND 157 Y+++LFL+RFG++ GVL+P +P A R IQ FNQG DIL+T+D Sbjct 301 YSIKLFLERFGMSCGVLTPIIPAATRRMLIQCFNQGSYDILVTSD 345 Lambda K H 0.319 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 54900960570 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40