bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1111_orf3 Length=155 Score E Sequences producing significant alignments: (Bits) Value 9615.ENSCAFP00000027714 172 2e-42 > 9615.ENSCAFP00000027714 Length=947 Score = 172 bits (437), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 88/153 (57%), Positives = 109/153 (71%), Gaps = 6/153 (3%) Query 3 ETDAVSVTQENLTNFVDQPPWTSSRLFERTQPGVVMGLAWTAMGGAVIFVEAVGRSAEQG 62 E D V VT ENL +FV +P +T R+++ T PGVVMGLAWTAMGG+ +FVE S + Sbjct 719 EADLVEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGSTLFVET---SPRRP 775 Query 63 SSKPSKGDFKPTGGSLKVTGQLGGVMNESCEIAMTFSRGFIKKQNPNNNYLFESAIHLHV 122 K SKGD GSL+VTGQLG VM ES IA TF+R F+ + +P N+YL S IHLHV Sbjct 776 RDKDSKGD---KDGSLEVTGQLGDVMKESARIAYTFARAFLMQHDPTNDYLVTSHIHLHV 832 Query 123 PEGATPKDGPSAGVTLASALLSLALNLNPKPDL 155 PEGATPKDGPSAG T+ +ALLSLA++ +P+L Sbjct 833 PEGATPKDGPSAGCTIVTALLSLAMDQPVRPNL 865 Lambda K H 0.312 0.130 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23746592502 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40