bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1102_orf1 Length=147 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0100 94.0 1e-18 > 5833.PF14_0100 Length=858 Score = 94.0 bits (232), Expect = 1e-18, Method: Composition-based stats. Identities = 41/94 (43%), Positives = 68/94 (72%), Gaps = 3/94 (3%) Query 47 LRGAGLSPDFVFCRSEEPLSEAARQKISLFAQVQPQNVFSVHNCENIYKVPLILEAQGLS 106 LR AGL PDF+FCR EEPL++ A +KI+LF+QV+ ++V S+H+ N+YKVPLIL+ Q + Sbjct 223 LREAGLKPDFIFCRCEEPLTQEAIKKIALFSQVKNEHVISLHDTSNVYKVPLILDKQNVC 282 Query 107 RRLIERLGLE---ASGRRRDAAASLEVWRRMAER 137 ++++L LE + + + + S +W+++A+R Sbjct 283 MNVLKKLNLENVVLNNKLQISPYSFNIWKQLADR 316 Lambda K H 0.330 0.144 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23033159460 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40