bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1091_orf1 Length=179 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_1230 74.3 2e-12 > 5807.cgd4_1230 Length=127 Score = 74.3 bits (181), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 38/122 (31%), Positives = 64/122 (52%), Gaps = 5/122 (4%) Query 50 MASAELLWQCVRRTSCFLKKSHGIVLTREPLNLTQKNTLRHSGLCHPRPLGLQLVGNNAA 109 M S ELLWQCV++ + F+KK++G T EP N+ NTL++SGL R + + LV N+ Sbjct 1 MFSTELLWQCVKKNTSFIKKNNGFTFTSEPFNIMNLNTLKYSGLAARRSISMDLVPNSNG 60 Query 110 -----VKLSYRPKNPNKARFPRRALCSKKFPKSHSKTKQLQQLVAQQRPDLVRLAKKRFH 164 K++ + + R P++ + + + K+ + RPDL +A R+ Sbjct 61 KLVKNAKITKKNTGSSTIRCPKKLISKVNLSNNFKQAKKTIKNQISSRPDLKNVAIIRYR 120 Query 165 KL 166 K+ Sbjct 121 KI 122 Lambda K H 0.318 0.128 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 36430169559 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40