bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1037_orf1 Length=116 Score E Sequences producing significant alignments: (Bits) Value 44689.DDBDRAFT_0190552 107 1e-22 > 44689.DDBDRAFT_0190552 Length=206 Score = 107 bits (267), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 49/101 (48%), Positives = 70/101 (69%), Gaps = 0/101 (0%) Query 8 FEELPAQVIAEACQLTKQNSIEGCKQSEVKIVYTPAGNLKKTANMETGQVGFKQQSLVKE 67 + ++PA ++ E CQL KQNSI+GCK++ V IVYTP NLKKTA ME GQV + + VK Sbjct 57 WNDIPANILEECCQLVKQNSIQGCKEASVDIVYTPWANLKKTAGMEAGQVLYHNEREVKY 116 Query 68 VQGVKKEKELLKALEKTRAEPAVDLAANRLERDRRERSERK 108 V+ V+K+ +++ +EKTR + VDL R RD+ ER E++ Sbjct 117 VRNVRKDSKIINRIEKTREKREVDLMHERDSRDKSERHEKR 157 Lambda K H 0.311 0.126 0.331 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22619469984 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40