bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1014_orf1 Length=88 Score E Sequences producing significant alignments: (Bits) Value 10090.ENSMUSP00000021217 136 1e-31 > 10090.ENSMUSP00000021217 Length=152 Score = 136 bits (343), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 63/87 (72%), Positives = 73/87 (83%), Gaps = 0/87 (0%) Query 2 SSQTLEQHYRDLSDKPFFRVLMNYMSSGPVVAMVWEGTDVVKQARKMLGETRPLDSQPGT 61 S + L+QHY DL D+PFF L+ YM+SGPVVAMVWEG +VVK R MLGET P DS+PGT Sbjct 44 SEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGT 103 Query 62 IRGDFCIDVGRNLIHGSDSVEAAEREI 88 IRGDFCI VGRN+IHGSDSVE+AE+EI Sbjct 104 IRGDFCIQVGRNIIHGSDSVESAEKEI 130 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23142708390 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40