bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1008_orf1 Length=137 Score E Sequences producing significant alignments: (Bits) Value 3702.AT1G49980.1 89.0 3e-17 > 3702.AT1G49980.1 Length=671 Score = 89.0 bits (219), Expect = 3e-17, Method: Composition-based stats. Identities = 50/118 (42%), Positives = 73/118 (61%), Gaps = 11/118 (9%) Query 17 CRRRVTA---LVSEIRAAVSSATGLSCSAGAGASRIVAKIASDMNKPNGQKIVEATGATT 73 CR R + + E+R++V S TGL+CSAG A+R++AK+ SD+NKPNGQ +++ +T Sbjct 210 CRERGLSGGEIAEELRSSVYSETGLTCSAGVAANRLLAKVCSDINKPNGQFVLQNDRST- 268 Query 74 AAATAATAAFLDSLNVRKIPGVGKYREKML-NALGIHTCGELLQHAPLLLYLLPKITA 130 F+ L VRKI G+GK E +L +ALGI TC E++Q LL L + +A Sbjct 269 ------VMTFVSFLPVRKIGGIGKVTEHILKDALGIKTCEEMVQKGSLLYALFSQSSA 320 Lambda K H 0.321 0.132 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22428990562 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40