bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0981_orf1 Length=141 Score E Sequences producing significant alignments: (Bits) Value 5478.CAGL0G07172g 96.3 3e-19 > 5478.CAGL0G07172g Length=866 Score = 96.3 bits (238), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 48/136 (35%), Positives = 73/136 (53%), Gaps = 2/136 (1%) Query 2 TGVPVTFQANINAFPQPLLGQGVIAYLDDVLIYSSDLPGHVSLLRQVLSTFLRHEFHPKF 61 T P TFQ +NA +P + + + YLDD+LIYS H+ + QVL +H +PK Sbjct 6 TNAPATFQRLMNAVLRPYISKFCVVYLDDILIYSKTREEHLHHISQVLDKLRKHSLYPKK 65 Query 62 RKCKFARQTITYLGYTISVAGIKPAEDKIEAIRHWPEVQENETQVRQFLGTINYCRMFMG 121 KC F + +LG+ I+ GI +KI AI+ WP + N ++FLG NY R F+ Sbjct 66 SKCHFMLTQVQFLGHVINANGISTDPEKINAIKQWP-ILRNYKDAQRFLGLANYYRRFIK 124 Query 122 PDYADVAGPPVDLTGK 137 +++ +A P + K Sbjct 125 -NFSKMASPLYEFAAK 139 Lambda K H 0.323 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22827922775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40