bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0952_orf1 Length=140 Score E Sequences producing significant alignments: (Bits) Value 3702.AT2G23070.1 190 1e-47 > 3702.AT2G23070.1 Length=432 Score = 190 bits (482), Expect = 1e-47, Method: Compositional matrix adjust. Identities = 89/139 (64%), Positives = 109/139 (78%), Gaps = 7/139 (5%) Query 1 LQVYDYSLDIWSLGCMLAGIIFRKEPFFYGHDNYDQLVKIARVLGTEGLYAYLEKYDLEL 60 LQ YDYSLD+WSLGCM AG+IFRKEPFFYGHDNYDQLVKIA+VLGT+ L AYL KY +EL Sbjct 299 LQDYDYSLDLWSLGCMFAGMIFRKEPFFYGHDNYDQLVKIAKVLGTDELNAYLNKYRIEL 358 Query 61 EKNFLQLIGKHSKKSWTRFINEENKTLAVPEAVDLLDKMLIYDHQQRILPRDALNHPYFQ 120 + N L+G+HS+K WT+FIN EN+ LAVPEAVD +DK+L YDHQ+R ++A+ HPYF Sbjct 359 DPNLTSLVGRHSRKPWTKFINSENQHLAVPEAVDFVDKLLRYDHQERPTAKEAMAHPYFY 418 Query 121 PVVEEEQRNAAAAAGEAPR 139 P+ RNA ++ PR Sbjct 419 PI-----RNAESS--RTPR 430 Lambda K H 0.321 0.139 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22914837435 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40