bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0943_orf1 Length=140 Score E Sequences producing significant alignments: (Bits) Value 203124.Tery_4785 65.5 5e-10 > 203124.Tery_4785 Length=767 Score = 65.5 bits (158), Expect = 5e-10, Method: Composition-based stats. Identities = 32/78 (41%), Positives = 46/78 (58%), Gaps = 1/78 (1%) Query 63 PVSSVSLLLVTETTEVLYSAMVPGYITGEFNLPDLTVDLAPLCSFAGASLITARAVGLLP 122 P+ V L L+T+ YS M+PGY+ G +N +DL PL FAGA + + A+G L Sbjct 31 PIPGVRLTLITDVYHTPYSGMLPGYVAGLYNFDQCHIDLLPLAKFAGARIFLSHAIG-LD 89 Query 123 QQKLLLLDGSRPPLRFDV 140 +K +L SRPP+ FD+ Sbjct 90 LEKNQILCTSRPPVNFDL 107 Lambda K H 0.316 0.131 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22914837435 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40