bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0935_orf1 Length=173 Score E Sequences producing significant alignments: (Bits) Value 393595.ABO_1725 79.0 6e-14 > 393595.ABO_1725 Length=738 Score = 79.0 bits (193), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 48/123 (39%), Positives = 66/123 (53%), Gaps = 11/123 (8%) Query 24 LAQSVDFFRLFTGDLYTMGRVAAAHALSDLYACGAEPLTALAVTLMQKAPPELQANNLLQ 83 L QS+DFF F + Y GR+AA H+LSD+YA A+P +ALA + P LQ+ +L + Sbjct 436 LVQSLDFFPAFIDEPYLFGRIAALHSLSDVYAMNAQPHSALANITLPWHHPRLQSRDLQR 495 Query 84 FLCGASSVFSSEGCELSGGHSAAGDGPS-AAGFCVTGRIFYPSPPGASSAKTNSSKGGND 142 + GA ++ GC L GGH+ +GP AAGF V G+ A A+ G D Sbjct 496 MMAGAVRELNAAGCTLVGGHTI--EGPQMAAGFTVNGQ--------ADPAQLWHKHGARD 545 Query 143 EKR 145 R Sbjct 546 GDR 548 Lambda K H 0.316 0.133 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 33476963958 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40