bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0903_orf1 Length=162 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE0975c 142 4e-33 > 5833.PFE0975c Length=133 Score = 142 bits (357), Expect = 4e-33, Method: Compositional matrix adjust. Identities = 65/129 (50%), Positives = 97/129 (75%), Gaps = 0/129 (0%) Query 34 FTLRLRKLQSNPLLQRKQLWVDVLHLGRANVSRKELQQRLAQQFKVPDPRCLVLCCFRTA 93 FT+R++K SNPLL+RKQ +++LH + +V++KE+++RLA+ +K+ + +VL F+T Sbjct 5 FTIRVKKYMSNPLLRRKQFALEILHPNKGSVAKKEVKERLAKMYKLNNVNTIVLFGFKTL 64 Query 94 FGGARSRGQALIYEDFRAAQRFERRFRLVRMGAAEAEPKKGRRATKELKNRRKKVRGTEK 153 FGG R++G LIY++ A ++FE+++RLVR G + E K GRRA+KELKNRRKKVRGTEK Sbjct 65 FGGGRTKGFGLIYKNVDAVKKFEKKYRLVREGLIDKETKAGRRASKELKNRRKKVRGTEK 124 Query 154 AKTQAGKQK 162 K K+K Sbjct 125 TKVSGAKKK 133 Lambda K H 0.320 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 27386790332 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40