bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0892_orf2 Length=160 Score E Sequences producing significant alignments: (Bits) Value 4952.YALI0E14399g 95.5 4e-19 > 4952.YALI0E14399g Length=814 Score = 95.5 bits (236), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 47/140 (33%), Positives = 75/140 (53%), Gaps = 1/140 (0%) Query 20 RICVPQFPEFLTQTLHSHHDHVTAGHGGQKKTFATLSKHQYWPGMLAYTTADVESSTHSR 79 R+CVP+ + + HD AGH G K++ L++ YWP M+ + S + Sbjct 372 RLCVPR-GKARKMLMKEAHDAPLAGHYGYFKSYERLARAYYWPRMIDHMRNHTRSCLICQ 430 Query 80 ASKSLNQKPAGLLRQLLIPSRRWAHVSLDFITDLPLTMTGHDSILVMVDSLSKMAHFFPA 139 +K+ P GLL+QL +P+ W +++DFI +P T GH++I V VD +SKM H P Sbjct 431 TTKARRAPPQGLLKQLPVPTGNWQEITMDFIGGIPTTHRGHNNIWVTVDRMSKMVHLIPC 490 Query 140 KKSFTAADTVELLADCLIRY 159 K S + ++ D ++RY Sbjct 491 KTSTDGEELADMYIDRIVRY 510 Lambda K H 0.325 0.135 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26871144147 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40