bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0885_orf1 Length=129 Score E Sequences producing significant alignments: (Bits) Value 8364.ENSXETP00000011968 61.2 8e-09 > 8364.ENSXETP00000011968 Length=495 Score = 61.2 bits (147), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 35/108 (32%), Positives = 57/108 (52%), Gaps = 10/108 (9%) Query 3 EDATRFQDSYHIGNLMFARGAMWDPSLFAQKKVVTTEGTAACSFERTAVLQDYIKRAVLC 62 +D + F+ ++M AR AMW+PS+F + ++ E V++DYI AV Sbjct 221 QDISAFRSVTSASSVMLARAAMWNPSVFRPEGMLPVE----------TVIRDYIAYAVQY 270 Query 63 GSPYQSIKFTLQEMTARDSDKKLKLDLVAANSTAKLCDVFGLGDFYKS 110 + Y + K+ L +M + L L AA ST ++C+VF + DFY+S Sbjct 271 DNHYTNTKYCLCQMLRDQLESPLGKRLHAAQSTLEICEVFEMSDFYES 318 Lambda K H 0.320 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22342951125 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40