bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0849_orf1 Length=147 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.118 143 1e-33 > 5833.MAL13P1.118 Length=1139 Score = 143 bits (361), Expect = 1e-33, Method: Composition-based stats. Identities = 61/132 (46%), Positives = 91/132 (68%), Gaps = 0/132 (0%) Query 7 EVREVRSKIIDLILATDMRTHFEFLNRFRTIRESDQFSFRRNDDDRWLAVELCIRASDIG 66 + R +RS II+LIL+TDM+ HFE +++FR RE++ F + +N DD + ++ I+++DI Sbjct 943 DFRMMRSYIIELILSTDMKHHFEIISKFRIRRENEDFDYIKNSDDLLILTKMIIKSADIS 1002 Query 67 HGVLGWKQHFEWTARATTEFYLQGDEEARLGRTISPLCDRETHSQLAKSQVGFLRHVVRP 126 HG + W +H+ W R +EFY QGDEE + +SPLCDR H+++ KSQ+ FL+ VV P Sbjct 1003 HGSVSWSEHYCWCQRVLSEFYTQGDEELKNKMPLSPLCDRTKHNEVCKSQITFLKFVVMP 1062 Query 127 LFAELQAIDDQK 138 LF EL ID+ K Sbjct 1063 LFEELSHIDNNK 1074 Lambda K H 0.325 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23033159460 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40