bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0838_orf3 Length=208 Score E Sequences producing significant alignments: (Bits) Value 44689.DDBDRAFT_0167252 63.5 3e-09 > 44689.DDBDRAFT_0167252 Length=572 Score = 63.5 bits (153), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 36/117 (30%), Positives = 59/117 (50%), Gaps = 15/117 (12%) Query 85 APPNQRQQQKQQLQQLVLTGDAAGAAALRLY---SMSDLLRSLFVFSLCRHHWLVDNWES 141 PPN + K L D + +LY S +L + + +C +++ DN + Sbjct 132 GPPNNQNNNKLDL-------DTS-----KLYVSKSTGELFFTFMILKVCSINFISDNSQK 179 Query 142 LLNVSCRIFGSRAVFAFIRFSFFKVFCGGEALEEVVQTLDKLKQRNLGAILDYAAEQ 198 LN+ ++ S+ + FI++SFFK FC GE + E +KL + +G ILDYA E+ Sbjct 180 FLNLFEKLGLSKPLNFFIKYSFFKQFCAGETIRETEIFTEKLNKLGIGTILDYAIEE 236 Lambda K H 0.324 0.134 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 52674479614 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40