bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0817_orf1 Length=191 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL3P4.14 178 9e-44 > 5833.MAL3P4.14 Length=432 Score = 178 bits (451), Expect = 9e-44, Method: Compositional matrix adjust. Identities = 77/170 (45%), Positives = 116/170 (68%), Gaps = 0/170 (0%) Query 20 ALPIVDQMVKEKVLDRNVFSVYMSEDINRPGEISFGAADPKYTFAGHTPKWFPVISLDYW 79 A P+++ + K+ +L RN+FS Y+ + + + G I+FG A+ KYT G + +WFPVISL YW Sbjct 229 ASPLIETIKKQNLLKRNIFSFYVPKKLEKSGAITFGKANKKYTVEGKSIEWFPVISLYYW 288 Query 80 EIGLHGLKINGKSFGVCEKRGCRAAVDTGSSLITGPSSVINPLIKALNVAENCSNLGTLP 139 EI L ++++ K+ +CE + CRAA+DTGSSLITGPS+ I PL++ +N+ +CSN +LP Sbjct 289 EINLLDIQLSHKNLFLCESKKCRAAIDTGSSLITGPSTFIQPLLEKINLERDCSNKESLP 348 Query 140 TLTFVLKDIYGRLVNFSLEPRDYVVEELDARGNANNCAAGFMAMDVPRPR 189 ++FVLK++ G+ + P DY++EE D N C G M +DVP PR Sbjct 349 IISFVLKNVEGKEITLDFMPEDYIIEEGDTENNTLECVIGIMPLDVPPPR 398 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 43048405750 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40