bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0781_orf1 Length=192 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd6_3960 144 2e-33 > 5807.cgd6_3960 Length=1100 Score = 144 bits (363), Expect = 2e-33, Method: Composition-based stats. Identities = 65/132 (49%), Positives = 90/132 (68%), Gaps = 0/132 (0%) Query 24 SGQVISAMKEACRAAMLQRGLCRICEAMLRFTLSCDQRVIGKAYSVLARRRGKIIKEEVP 83 S Q+ + KE CR A LQRG RI E L + C+Q V+GK YSV+ +RRG + EE+ Sbjct 875 SNQLTTTTKELCRKAFLQRGNVRIYEIYLNLVIYCEQSVLGKVYSVINKRRGNVFNEELK 934 Query 84 EGQTSFVVFGFLPTAEAPGISQEIRSKASGHASLQLQFSHWEVLQEEPFPEACMTEQELE 143 EG ++F + ++P E+ GISQE+RSKASG+ S L FSHWE+L E+PFPE+ MT +E E Sbjct 935 EGTSTFKIEAYIPIIESLGISQELRSKASGNISFNLSFSHWELLDEDPFPESSMTMEEFE 994 Query 144 DEGEAALSSLAT 155 DEG + ++ L + Sbjct 995 DEGFSKVNLLIS 1006 Lambda K H 0.315 0.128 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 43663382975 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40