bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0775_orf3 Length=173 Score E Sequences producing significant alignments: (Bits) Value 9031.ENSGALP00000004641 231 7e-60 > 9031.ENSGALP00000004641 Length=2335 Score = 231 bits (589), Expect = 7e-60, Method: Compositional matrix adjust. Identities = 102/173 (58%), Positives = 127/173 (73%), Gaps = 2/173 (1%) Query 1 QPPFLADLEPLGWIHTQPNENPQLLPRDVLAHAKILNENKNWDAATAAVVTCAFTPGSCS 60 Q +L ++EPLGWIHTQPNE+PQL P+DV HAK++ +N +WD ++TC+FTPGSC+ Sbjct 2165 QHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKVMADNPSWDGEKTIIITCSFTPGSCT 2224 Query 61 LTAYRLTPQGYQWGKANRDMSATPAGYSKGHAERAQMLLSDVFSGFFLVPAEGGGIWNYN 120 LTAY+LTP GY+WG+ N D P GY H ER QMLLSD F GFF+VPA+G WNYN Sbjct 2225 LTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQGS--WNYN 2282 Query 121 FMGVKFSPAMKYSLVLDTPKDFYHEAHRPAHFLQFTQLEQQEADVAEREDLFA 173 FMGV+ P MKY L L PK+FYHE HRP+HFL F L++ E A+REDL+A Sbjct 2283 FMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA 2335 Lambda K H 0.319 0.134 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 33476963958 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40