bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0758_orf1 Length=191 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_3460 153 3e-36 > 5807.cgd5_3460 Length=710 Score = 153 bits (386), Expect = 3e-36, Method: Compositional matrix adjust. Identities = 71/154 (46%), Positives = 97/154 (62%), Gaps = 0/154 (0%) Query 13 ANFAKNKHVELLVKKYERHLKQQMRRKLARLGADLETRFRIIRTQESNCGNWLCELMRKE 72 + F N+HV +V KY R L QM + + LETRF +IRT E+N GNWL ++MR Sbjct 380 STFNPNRHVTKMVNKYLRDLATQMDKIIGECAVRLETRFSVIRTSETNAGNWLTDIMRSA 439 Query 73 CKSDIAFINSGTIRSDCIFKKGDFRFGDLAAMLPMADEIAVVRCKGSVLLAALENAVSQV 132 K++IA INSGTIRSDC+F G R D+ MLP D + + G++LL LEN+VSQ Sbjct 440 AKTEIALINSGTIRSDCVFNIGPVRNQDILMMLPFVDNLVKLGVPGNLLLDILENSVSQW 499 Query 133 PKTEGRFLQVAGIRFEFDSSKPSGNRIIRETVKV 166 P +GRF QV+G++F F+ P G RI+ +V + Sbjct 500 PNKDGRFSQVSGLKFRFNGDLPPGQRIVPGSVYI 533 Lambda K H 0.323 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 43048405750 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40