bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0734_orf1 Length=199 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0014 183 3e-45 > 5833.PF13_0014 Length=194 Score = 183 bits (464), Expect = 3e-45, Method: Compositional matrix adjust. Identities = 80/179 (44%), Positives = 133/179 (74%), Gaps = 0/179 (0%) Query 17 SQPTEVEKEVDRCLADIESSAQSELRAEVAELTICAVKPVEVPASGKTALVIFVPYRVYM 76 S P+++EKE+ +CL DIE S+ S+++ + E+ + + +EV K ++I++PY++Y Sbjct 11 SNPSDLEKEIAQCLLDIELSSSSDIKTDAKEIKLLSCDLIEVEKLKKKTILIYIPYKIYT 70 Query 77 NVVKRIHARLVQELEKKLKRHVVIIAQRSIVGLDYKRKNLKVRPRSRTLTNVQDAMLEDI 136 V++I +L+ ELEKK K++VV++A+R+I+ K K+ K+ PRSRTLT+V D++LEDI Sbjct 71 TYVRKIQRKLINELEKKTKKYVVLVAKRTILKGKQKNKSFKIIPRSRTLTSVYDSILEDI 130 Query 137 VAPSEVVGRRWRVRADGSKLMKVHLDPKDKAKDNLEEKLWTFAAVYKRLTNKDAAFLFP 195 V+PSE++G+R ++ADG ++ K+ LD K++ +DN+EEKL +FAAVYK++T +DA F P Sbjct 131 VSPSEIIGKRISMKADGKRVFKIMLDSKERQRDNIEEKLISFAAVYKKITRRDAVFSLP 189 Lambda K H 0.320 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 47162034073 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40