bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0699_orf3 Length=169 Score E Sequences producing significant alignments: (Bits) Value 8090.ENSORLP00000011750 106 3e-22 > 8090.ENSORLP00000011750 Length=118 Score = 106 bits (264), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 54/95 (56%), Positives = 70/95 (73%), Gaps = 0/95 (0%) Query 59 PTRILLLLNMVGRGQVDSDLKEETEEEAAKLGNLLQVRIFEAAGVPDDCAVRIFCEYERK 118 PT+++LL NMVGRG+VD DL+ ET+EE K G +++ IFE A VPDD AVRIF E+ER Sbjct 20 PTKVVLLRNMVGRGEVDEDLEGETKEECEKYGKVVKCVIFEIAEVPDDEAVRIFLEFERV 79 Query 119 EEATRALLTFNGRAFGGRTVKAKFYSEERFARGDL 153 E A +A++ NGR FGGR VKA FY+ ++F DL Sbjct 80 ESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDL 114 Lambda K H 0.326 0.141 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30997188850 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40