bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0631_orf3 Length=180 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_2730 68.6 8e-11 > 5807.cgd1_2730 Length=693 Score = 68.6 bits (166), Expect = 8e-11, Method: Composition-based stats. Identities = 32/90 (35%), Positives = 56/90 (62%), Gaps = 4/90 (4%) Query 88 SSLIVLKNLLPAEEVDEQLQQEILEQCKKYGRVREVRVH----IVESTKEVRVFALFTLP 143 +++I+L N++ +E+D++L++E+ +C KYG+V +VR+H I + + VR+F +F P Sbjct 597 TNIILLTNMVGPDEIDDELKEEVKIECSKYGKVYDVRIHVSNNISKPSDRVRIFVVFESP 656 Query 144 EEANRALRILPKRKFNKKKVECELYDYEAY 173 A A+ L R F +V C LY+ E Y Sbjct 657 SMAQIAVPALNNRWFGGNQVFCSLYNTERY 686 Lambda K H 0.320 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 37047630060 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40