bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0612_orf3 Length=400 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL3P4.18 63.2 2e-08 > 5833.MAL3P4.18 Length=953 Score = 63.2 bits (152), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 27/80 (33%), Positives = 45/80 (56%), Gaps = 2/80 (2%) Query 226 GTVRRLNGTARGTGCRPKQQPSATTSTWSLTDSSGRVILLDWRDGRMEKLFFEVYESLLR 285 GT++R++ GT R + + S W + D + ++I + W + EKLFFE +E+ ++ Sbjct 864 GTIKRISENT-GTAYRS-MEMNKINSIWMIRDKNNKIINVKWENKIFEKLFFETFENYIK 921 Query 286 QHILHNHPQWFTYPYNGEAI 305 ++I H W YPYNG I Sbjct 922 KYINDYHRDWRNYPYNGSKI 941 Lambda K H 0.310 0.123 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 160009490070 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40