bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0595_orf1 Length=188 Score E Sequences producing significant alignments: (Bits) Value 4952.YALI0F29645g 85.1 1e-15 > 4952.YALI0F29645g Length=352 Score = 85.1 bits (209), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 61/158 (38%), Positives = 75/158 (47%), Gaps = 51/158 (32%) Query 6 MCRLTAIITRG-DPILLADILTRPRRSIIQQSFNCQERLPQDDIRNAYQKASLNGDGFGV 64 MCR +I +G +PILLA +LTRP SII QSF+ + RL D R +NGDGFGV Sbjct 1 MCRF--LIFKGKEPILLAHLLTRPAHSIINQSFDSRLRL--DMTR------PINGDGFGV 50 Query 65 GWYITKGSNSTVPGTSLSLLRACNSNRNNTNGKTVPDSEAAVTNDSSFEDDGGACVFTSL 124 G+Y T D E D G CVF ++ Sbjct 51 GYY---------------------------------------TMDRDLELDAGPCVFCAI 71 Query 125 KPAWADRNLYNLAEKISSRLFFAHVRAASS-TLGWSQC 161 PAW + NL LA K S L FAHVRA++S TL + C Sbjct 72 TPAWNNTNLARLANKTKSDLVFAHVRASTSGTLSETNC 109 Lambda K H 0.318 0.132 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 41203474075 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40