bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0550_orf1 Length=172 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_300 72.8 4e-12 > 5807.cgd4_300 Length=342 Score = 72.8 bits (177), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 42/111 (37%), Positives = 59/111 (53%), Gaps = 5/111 (4%) Query 10 PWVRSVRHAALVYPSLCRGCPTRSHLL---FGDKNTLRNDIWFAFAH-TQTLGPVWDWRQ 65 WV V+ L+YP+LC+ C T S L FG N L + +WF + ++ + +DWR Sbjct 218 KWVDHVKFLGLIYPALCQKCITNSKLKNFRFGFLN-LNSLLWFEKQYQSKYIENYFDWRS 276 Query 66 IPFAIPAKILSQFPPTSLILFTHDIQYETGVLFHEKLRRAGVPTSLFIAPG 116 P PA IL +FP TS++L DI Y+ G L +E L + V L I G Sbjct 277 QPLLAPANILRKFPKTSIVLMKSDILYDEGRLMYEILLKLKVNVKLKIFTG 327 Lambda K H 0.325 0.137 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 32857020181 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40