bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0548_orf4 Length=195 Score E Sequences producing significant alignments: (Bits) Value 376686.Fjoh_0022 204 8e-52 > 376686.Fjoh_0022 Length=372 Score = 204 bits (520), Expect = 8e-52, Method: Compositional matrix adjust. Identities = 96/178 (53%), Positives = 127/178 (71%), Gaps = 0/178 (0%) Query 3 AGIGATVVIMDCNFTRLRFLDDILPRNCTTRYFSEAALVQELGDADLVVGAVLLAGCKAP 62 AG+GA V IMD + RLR LDDI+P N T + + + + DADL+VGAVL+ G KAP Sbjct 188 AGLGAQVTIMDLSLPRLRQLDDIMPANVNTEMSNHYNITRAIKDADLIVGAVLIPGAKAP 247 Query 63 KLLRREHLKRMQRGSLVVDVAVDHGGCCETSRGTSHAAPTFEVEGILHYGVANMPGAVPV 122 L+ R+ LK M+ G++VVDVAVD GGC ET T+H PTF ++ I+HY VANMPGAVP Sbjct 248 HLITRDMLKLMRPGTVVVDVAVDQGGCIETCTPTTHENPTFIIDDIVHYCVANMPGAVPY 307 Query 123 TATAALASATLPYVLQIANFGWAEACSRCEALRKGLSVARGRVLHAGVAATFNFPVSS 180 T+T AL +ATLPY +Q+AN GW +AC+ E L+KGL+VA G++L+ GVA +N P + Sbjct 308 TSTLALTNATLPYAVQLANKGWEKACAENEELKKGLNVANGKILYKGVAEAWNLPFNE 365 Lambda K H 0.322 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 45508314650 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40