bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0540_orf1 Length=166 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.234 60.8 2e-08 > 5833.MAL13P1.234 Length=5987 Score = 60.8 bits (146), Expect = 2e-08, Method: Composition-based stats. Identities = 40/151 (26%), Positives = 68/151 (45%), Gaps = 40/151 (26%) Query 2 VTVLKEEALPPRHFVVLFYPKDVFFVDLTGAPQVAGGHQVGDESEPTRDKSVNVLWHASI 61 +TV K+E PP H+ +L YPK + + +L A + ++ + K+ V+W I Sbjct 5868 LTVHKQENHPPSHYALLLYPKVIIYANL-----YANTNAQKNDFLLSEKKTDIVIWSIKI 5922 Query 62 PLVRDIRASTHGIIIRAGQPTTHRPKDVLAALSSVDSYQKSHRAHVGSLRQVEARGDRCF 121 + +IRAS+HG+I+R T + + Sbjct 5923 EDITEIRASSHGLIVRTNTST-----------------------------------NTVY 5947 Query 122 QIPCSSAALISQLYRELLEAVHGSTSVVQLG 152 +IPC++A LI+++YREL + + S V LG Sbjct 5948 KIPCNNAILINKIYRELHNSKNSINSTVILG 5978 Lambda K H 0.319 0.133 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 29876498544 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40