bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0478_orf3 Length=118 Score E Sequences producing significant alignments: (Bits) Value 33169.AGOS_ADR073W 100 1e-20 > 33169.AGOS_ADR073W Length=452 Score = 100 bits (248), Expect = 1e-20, Method: Composition-based stats. Identities = 48/108 (44%), Positives = 72/108 (66%), Gaps = 0/108 (0%) Query 1 WTLLRKRVIQHNLRVLCANYSVIHLQRVASLLGIPEEEAESELSELASAGVLYAKIDRPA 60 W LRKRVI+HNLR + Y+ I L R+ LL + E E E+ +S L + G++YAKI+RPA Sbjct 345 WDDLRKRVIEHNLRTISKYYTRITLPRLNELLDLNEAETETFISNLVNQGIIYAKINRPA 404 Query 61 RTVAFGKPKTDLVVLEEWSSSLSKLLDKVDLCCHMIQKERMVHAARAK 108 + V FGKPK +L EWSS++ +LL+ ++ H+I + ++H +AK Sbjct 405 KIVNFGKPKNSSELLNEWSSNVDQLLEHIETIGHLITSDEIMHGLKAK 452 Lambda K H 0.320 0.129 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22460540320 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40