bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0465_orf1 Length=204 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd3_2630 95.5 1e-18 > 5807.cgd3_2630 Length=919 Score = 95.5 bits (236), Expect = 1e-18, Method: Composition-based stats. Identities = 49/108 (45%), Positives = 72/108 (66%), Gaps = 3/108 (2%) Query 86 QKIDDGLIEVVAFKSLFHLGQVQVGLAKALRLCQGRSVCLHVSGSLPLQVDGEPQLLEGS 145 QKIDDGLIEVV +SLFHL Q+QVGL + ++LCQG + +++ LP QVDGEP+++ Sbjct 800 QKIDDGLIEVVGIRSLFHLTQLQVGLTEPIKLCQGSHIVVYIPRQLPFQVDGEPRIIN-K 858 Query 146 CRIAITHNCQAPVLVASEKSPRMQTLSVVQEVLNRARDRRVISKMQCA 193 C++ I + + PV + SEK +LS VQ L +A +++I+ Q A Sbjct 859 CKLIIEQSGKIPV-ICSEKIENTVSLS-VQNALEQAVQKKIINTSQRA 904 Lambda K H 0.321 0.132 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 50224503818 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40