bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0441_orf2 Length=123 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI0775w 73.9 1e-12 > 5833.PFI0775w Length=217 Score = 73.9 bits (180), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 37/112 (33%), Positives = 62/112 (55%), Gaps = 4/112 (3%) Query 8 SSSGRMREAAKALRNSRGGSVVTADELIAWELKELGIPKMRKDQNSGVKGMLWMKRALDF 67 SSS R K ++ S++ + + +E + K+++D ++G+ LWMKR L+F Sbjct 63 SSSQVQRAIEKFPEETKYVSMLYSYNINKYE----NMEKLKRDLDNGIISFLWMKRTLEF 118 Query 68 VFTLICNTFGTMKDATVKECALDAYDRVLKPYHSFLVSNIVSLAFSLAPSKD 119 + T + + T + + CA +AY+ VLK YH F+ S IV L L+P+KD Sbjct 119 IITFLEKCYITCSETKLSICAQEAYNEVLKKYHGFITSKIVKLCLKLSPTKD 170 Lambda K H 0.321 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22834639773 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40