bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0424_orf4 Length=184 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0315 64.3 2e-09 > 5833.PF13_0315 Length=509 Score = 64.3 bits (155), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 28/65 (43%), Positives = 44/65 (67%), Gaps = 0/65 (0%) Query 10 FGAVVSVYVXLDKESGRNKGFGFVSYTTPAAAAAAVNAMNNCLVSNKRLNVSIKKGEERH 69 FG ++S + +K +GRN+GF FVSY + +AAAA++ MN + NK+L V++KKGEE Sbjct 392 FGELLSARIATEKNTGRNRGFAFVSYDSLESAAAAISQMNGFMALNKKLKVTVKKGEEDE 451 Query 70 AAMHL 74 ++ Sbjct 452 MKKYV 456 Lambda K H 0.309 0.122 0.341 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 39517472064 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40