bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0415_orf3 Length=249 Score E Sequences producing significant alignments: (Bits) Value 9031.ENSGALP00000018762 89.0 1e-16 > 9031.ENSGALP00000018762 Length=314 Score = 89.0 bits (219), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 52/144 (36%), Positives = 74/144 (51%), Gaps = 13/144 (9%) Query 45 VARAAQQQCGECLPMPHSADGVFLDLPSPWLAIKHASVALKG-GGRLVTFSPCLEQLHKT 103 V Q C + AD VFLD+PSPW AI HA ALK GGR+ +FSPC+EQ+ +T Sbjct 163 VTVTNQDVCKNGFGVSGIADAVFLDIPSPWEAIGHAKSALKAEGGRICSFSPCIEQVQRT 222 Query 104 LAAAQEHGFQDFQAFEILAKPWGA-CISRPTPDQRKHEDDVEEGDVSHNLKAEKQSERGA 162 A +E+GF + EIL + + IS PD K +D + S + S +G+ Sbjct 223 CLAMEEYGFTEINTLEILLRVYNVRTISLQIPDLGKAAED----NSSAGFDSSNPSNQGS 278 Query 163 QGGQVQQPT-------PFRDLLSH 179 G +QQ T P ++++ H Sbjct 279 PGTNLQQGTVQFKSGVPLKEMVGH 302 Lambda K H 0.316 0.131 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 75025471004 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40