bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0414_orf2 Length=169 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_2470 129 3e-29 > 5807.cgd5_2470 Length=312 Score = 129 bits (325), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 73/161 (45%), Positives = 95/161 (59%), Gaps = 10/161 (6%) Query 18 EGAPGPCI---VEESGPDLPEHFTKEQDLYPS-------NFPKEGDLVLLYGSRDIIVPC 67 EG P P V S DL E+F + S K GDLV+L+G ++++ Sbjct 5 EGIPEPTNLGNVSASLEDLEENFEGSNIVNKSYTQRRRYEMCKNGDLVVLFGGYEMVIQV 64 Query 68 VLRKGGVCRTRLGNFEHADIMRTPMGQKVQDRRSGKWLVVLRPTPDLHTLALRHRTQIIY 127 L + G +TR G F H +I+ G ++ D KW+VVL+ +P+L +++L HRTQI+Y Sbjct 65 FLEQNGRTQTRNGVFLHNEIIGKNFGSRIFDTSKSKWMVVLKLSPELISISLNHRTQILY 124 Query 128 HADISLIMSLLDVCPGKTIIEAGTGSGSLTVSLAASLRPGG 168 ADISLI LLD PGK IIEAGTGSGSLTVSL S PGG Sbjct 125 QADISLICVLLDASPGKNIIEAGTGSGSLTVSLCRSTNPGG 165 Lambda K H 0.321 0.140 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30997188850 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40