bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0401_orf1 Length=296 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE0430w 159 9e-38 > 5833.PFE0430w Length=1490 Score = 159 bits (403), Expect = 9e-38, Method: Composition-based stats. Identities = 73/122 (59%), Positives = 95/122 (77%), Gaps = 0/122 (0%) Query 18 LKKELPLVDHASCKFPPIKKNLYVQVKELTDLKDHEVEAIRKTNGNIKVRGKQCPRPIST 77 + K+L V+H + PIKKN+YVQVKE+T++KD +V+ RK NGNI VRGK CPRP+ Sbjct 665 MNKKLLEVNHDEIDYIPIKKNIYVQVKEITNMKDSDVDMFRKNNGNIIVRGKNCPRPVQY 724 Query 78 FHQCGLPEKILRHLELRGFEKPFPVQSQCIPILMCGRDLIAVAETGSGKTLAYALPLVRH 137 F+QCGLP KIL+ LE + F+K + +Q Q IP LMCGRD+IA+AETGSGKTL+Y P++RH Sbjct 725 FYQCGLPSKILQILEKKNFKKMYNIQMQTIPALMCGRDVIAIAETGSGKTLSYLFPVIRH 784 Query 138 VL 139 VL Sbjct 785 VL 786 Lambda K H 0.317 0.136 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 101413109161 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40