bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0392_orf2 Length=210 Score E Sequences producing significant alignments: (Bits) Value 9544.ENSMMUP00000032836 147 3e-34 > 9544.ENSMMUP00000032836 Length=1917 Score = 147 bits (370), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 71/160 (44%), Positives = 96/160 (60%), Gaps = 0/160 (0%) Query 2 VSLDFVTDLPLTTTGHDAILVVVDSLSKMAHFIPAKKSHSAGDTVELLADRLIRYHGFPD 61 +S+DFV+ LP T G D+I VVVD SKMAHFIP KS A ++ ++R HG P Sbjct 715 ISMDFVSGLPRTKRGRDSIFVVVDRFSKMAHFIPCHKSDDAVHIADMFFHEIVRLHGMPS 774 Query 62 VLVSDRGPHFQSEVWSQLCSRFNITRAMSSSYHPQTDGQTERVNRTLEQMLRTYIQTDER 121 +V DR S W L + S+S HPQTDGQTE VN+TL +LR ++ + + Sbjct 775 TIVIDRDAKLLSHFWRTLWNNLGTKLLFSTSCHPQTDGQTEVVNQTLGTILRAILKKNLK 834 Query 122 EWEGLLPALELAYNTTSHSSTELSPFEIMIGENPLTAADL 161 WE LP +E AYN +HS+T++SPF+I+ G NP D+ Sbjct 835 MWEECLPHVEFAYNRATHSTTKVSPFQIVYGFNPRARIDI 874 Lambda K H 0.321 0.135 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 53070928551 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40