bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0352_orf1 Length=143 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd3_3970 181 5e-45 > 5807.cgd3_3970 Length=179 Score = 181 bits (459), Expect = 5e-45, Method: Compositional matrix adjust. Identities = 85/136 (62%), Positives = 101/136 (74%), Gaps = 0/136 (0%) Query 1 EQIWPKKASPVLLKCQNRISLVVLDGKALFFQHRDRQWVPTLRLLHEYPSMMPKMQVDRG 60 + I PKK + +L KC +VLD LFFQ RD W PTLRLLH+YP MMP MQVD+G Sbjct 40 DDILPKKENIILSKCSGHFQFIVLDSIPLFFQQRDGPWFPTLRLLHKYPDMMPTMQVDKG 99 Query 61 AVKFVLRGSNVMCQGLTSPGGRMEEVPANTVVQIAVEGKELSCAIGITTMSTDEIRRENK 120 A+K VL+GSN+MC GLTSPGGRME+V VV+I EG + +CAIGITTMSTDEIR+ NK Sbjct 100 AIKHVLKGSNIMCPGLTSPGGRMEQVEQKQVVKIVGEGCQNACAIGITTMSTDEIRQINK 159 Query 121 GPCIETLTSLNDGLWS 136 G CIE + LNDGLW+ Sbjct 160 GVCIENVHYLNDGLWN 175 Lambda K H 0.321 0.136 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22654093455 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40