bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0338_orf1 Length=106 Score E Sequences producing significant alignments: (Bits) Value 5085.AFUA_1G06190 122 3e-27 > 5085.AFUA_1G06190 Length=352 Score = 122 bits (306), Expect = 3e-27, Method: Composition-based stats. Identities = 51/102 (50%), Positives = 71/102 (69%), Gaps = 0/102 (0%) Query 4 YSIQLRRKDFLHAFVAWFDVVFSKCHKPVILSTSPHNRYTHWKQTVFYMEHVLVGEVGDT 63 +S+ ++R DF+HA +AWFD+ F+ CHKP+ ST PH +YTHWKQTVFY+ VL E + Sbjct 251 FSLPVKRSDFIHAIIAWFDIDFTACHKPISFSTGPHAKYTHWKQTVFYLRDVLTVEEEEC 310 Query 64 VKGLIAVKKNKKNPRDLDIKISYEFQNRHTLKPISNTQFYRL 105 V G++ K N KNPRDLDI+ISY+ + L+ + FYR+ Sbjct 311 VSGILENKPNDKNPRDLDIQISYKLETTDKLRYDEGSCFYRM 352 Lambda K H 0.326 0.138 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22605445551 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40