bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0331_orf2 Length=175 Score E Sequences producing significant alignments: (Bits) Value 6239.K09A9.4.2 63.2 3e-09 > 6239.K09A9.4.2 Length=716 Score = 63.2 bits (152), Expect = 3e-09, Method: Composition-based stats. Identities = 31/75 (41%), Positives = 41/75 (54%), Gaps = 5/75 (6%) Query 3 GAGRSSASPALSSGYGYKLVALVEHEGPATEQGHYVCYIKHMDSDSWFRADDKVVEPVDL 62 G +S PAL Y LV V HEG + E GHYV Y +H + W++ DD VV D Sbjct 478 GRWTTSGEPAL-----YDLVGFVVHEGRSLEFGHYVSYCRHEQDNQWYKFDDMVVTRCDA 532 Query 63 QRVLAASPYILFYQR 77 +V + PYIL Y++ Sbjct 533 TQVAKSQPYILMYRK 547 Lambda K H 0.313 0.132 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 34716851512 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40