bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0320_orf1 Length=194 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE0885w 156 3e-37 > 5833.PFE0885w Length=716 Score = 156 bits (395), Expect = 3e-37, Method: Composition-based stats. Identities = 80/176 (45%), Positives = 113/176 (64%), Gaps = 17/176 (9%) Query 2 PKRKSKTERRFGPNSRSQWSPQGSFLATFHRQGISLWAGRNFEKKARLEHKEVKQIMFSP 61 P+ T ++ P S QWS QGS+L +FH GI+LW G +FEK RL+HK VK+IMFSP Sbjct 199 PQLIYTTFKKNAPFSSVQWSNQGSYLVSFHNPGIALWGGDSFEKLIRLQHKSVKEIMFSP 258 Query 62 KETYMLSWDGTPASMRNEKAFKTWNVMTGEMLRQFATPAATPRGTEFPHFLFSHDEKYLA 121 E Y+L+WDGTP S+RNEK+ W V+TG++LR F TP +P+ FPHFL+S D+KY+A Sbjct 259 NENYVLTWDGTPYSLRNEKSICIWRVITGKLLRSFITPEYSPKEKMFPHFLWSPDDKYIA 318 Query 122 KIG-DKELCIYAMDPKDNFPDQAADEDVTPVKLLRDEKGHFSALKYP-VEKFEWSP 175 IG KE+ +Y ++ + L+ D++ + LKY V++F+WSP Sbjct 319 CIGKQKEVYVY---------------ELPSMLLIEDQEKKRTPLKYSGVKEFDWSP 359 Lambda K H 0.319 0.134 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 44893337425 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40