bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0275_orf3 Length=184 Score E Sequences producing significant alignments: (Bits) Value 3702.AT2G21060.1 95.9 5e-19 > 3702.AT2G21060.1 Length=201 Score = 95.9 bits (237), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 44/77 (57%), Positives = 59/77 (76%), Gaps = 1/77 (1%) Query 15 DIQRGTCKWFDSKKGFGFITSDD-GTDLFVHQTEIKADGFRNLCEGEEVEFQVQSGDDGR 73 D ++GT KWFD++KGFGFIT D G DLFVHQ+ I+++GFR+L E VEF V+ + GR Sbjct 13 DRRKGTVKWFDTQKGFGFITPSDGGDDLFVHQSSIRSEGFRSLAAEESVEFDVEVDNSGR 72 Query 74 KKAVRVTGPGGAPVKGD 90 KA+ V+GP GAPV+G+ Sbjct 73 PKAIEVSGPDGAPVQGN 89 Lambda K H 0.311 0.145 0.459 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 39517472064 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40